PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn331841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 742aa    MW: 81843.2 Da    PI: 7.2984
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn331841genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.5e-095836152254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 ++yp+ +++  LA+++gL+ +qV++WF N R +
  Achn331841 583 HPYPTDTDKHMLATRTGLSRNQVSNWFINARVR 615
                 89*****************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.6E-5376499IPR006563POX domain
PfamPF075261.4E-8381484IPR006563POX domain
PROSITE profilePS5007111.693556619IPR001356Homeobox domain
SMARTSM003896.8E-8559623IPR001356Homeobox domain
CDDcd000862.36E-11559620No hitNo description
SuperFamilySSF466891.45E-16561625IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-26562623IPR009057Homeodomain-like
PfamPF059205.6E-18576615IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MHVYRQMQKN RLGSRYAGSY IGEQYFLMES NNFRPESHVA QRSRRDKLRV QQNSAAQAQH  60
LEDYPNNYEQ LSFHQEINPT DLRYGNISYN PYNPAMFSSE MLNVAENSQV LVAHKGGDRP  120
VVDGSSDSFG NSSLPMSSMF NSVAKMSGDP QNCGGIWKSI GSQQSCDWIV NYSSGLTGGE  180
SNPTPMFVGE GLASDVKVNA NLSSHSLYLK PSFNWYQDVQ SLLTNPSSEV SNLNNRKHYE  240
EMHFNSHPLY PNPLLLPNYG DQSNTWMSGE LGYLSNKSNR DLRVVASDAN TQGLSLSLSS  300
VHPSKPQTSQ CREDLHSGIG VLNDLHGSKG LKNDFLCSNL KPTIGGSRVL GSSTSQEMVG  360
SSAFAHRNTV PLGPFTGYAT ILKGSKFLKP AQVMLHEICS AMDPQPIRTC EVYDKGGSDE  420
ISGSADAVNV AESLVGAKGG DSGVSSSTCY DSNEMSGEAC DRSSSGERPE YQQKKAMLLF  480
MHEETISRHF RCLKNAISDQ IKHIRKAFGE DLLNPTTCAT SSRGDTRSSG VIKFVDHSFM  540
KPKSGGGNMG FFEPQQPVWR PQRGLPERSV AILRSWLFDH FLHPYPTDTD KHMLATRTGL  600
SRNQVSNWFI NARVRLWKPM VEEIHMLETK GLAEPNSNMG KTNGQPTSPS EGPSFPSDDH  660
PTAEQWNREK RSKVECQISS ATDSSSLLGF VPYHRSGLKI GGLGPVSLTL GLRQSAESVQ  720
QQQEHQIRQH FGGQMIHDFV G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-14565623563Homeobox protein Meis2
4xrm_B1e-14565623563Homeobox protein Meis2
4xrs_A7e-15565622158Homeobox protein Meis1
4xrs_B7e-15565622158Homeobox protein Meis1
5bng_A8e-15565623159Homeobox protein Meis2
5bng_B8e-15565623159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282519.20.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651200.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651201.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651202.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651203.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651204.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A068UHG50.0A0A068UHG5_COFCA; Uncharacterized protein
STRINGVIT_06s0004g02580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-61BEL1-like homeodomain 8